Lineage for d3l0ja_ (3l0j A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343025Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)
  8. 2343084Domain d3l0ja_: 3l0j A: [212638]
    automated match to d3l0la_
    protein/DNA complex; complexed with hc9

Details for d3l0ja_

PDB Entry: 3l0j (more details), 2.4 Å

PDB Description: Crystal structure of orphan nuclear receptor RORgamma in complex with natural ligand
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d3l0ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0ja_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfs

SCOPe Domain Coordinates for d3l0ja_:

Click to download the PDB-style file with coordinates for d3l0ja_.
(The format of our PDB-style files is described here.)

Timeline for d3l0ja_: