Lineage for d3l0ib_ (3l0i B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125340Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)
  8. 2125612Domain d3l0ib_: 3l0i B: [212636]
    automated match to d3dz8a_
    complexed with cl, so4

Details for d3l0ib_

PDB Entry: 3l0i (more details), 2.85 Å

PDB Description: complex structure of sidm/drra with the wild type rab1
PDB Compounds: (B:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d3l0ib_:

Sequence, based on SEQRES records: (download)

>d3l0ib_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smnpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
qiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllv
gnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

Sequence, based on observed residues (ATOM records): (download)

>d3l0ib_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklq
iwdtagqerfrtitssrgahgiivvyvtdqesfnnvkqwlqeidryaenvnkllvnkcdl
tkvvdyttkefadslgipfletsatnveqsfmtmaaeikkrm

SCOPe Domain Coordinates for d3l0ib_:

Click to download the PDB-style file with coordinates for d3l0ib_.
(The format of our PDB-style files is described here.)

Timeline for d3l0ib_: