Lineage for d3l0ha2 (3l0h A:81-222)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712858Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. 2712872Domain d3l0ha2: 3l0h A:81-222 [212633]
    Other proteins in same PDB: d3l0ha1, d3l0hb1
    automated match to d1agsa1
    complexed with gtx; mutant

Details for d3l0ha2

PDB Entry: 3l0h (more details), 2.13 Å

PDB Description: crystal structure analysis of w21a mutant of human gsta1-1 in complex with s-hexylglutathione
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d3l0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0ha2 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d3l0ha2:

Click to download the PDB-style file with coordinates for d3l0ha2.
(The format of our PDB-style files is described here.)

Timeline for d3l0ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l0ha1