![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
![]() | Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries) |
![]() | Domain d1g9mh2: 1g9m H:130-229 [21263] Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh1, d1g9ml1 |
PDB Entry: 1g9m (more details), 2.2 Å
SCOP Domain Sequences for d1g9mh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9mh2 b.1.1.2 (H:130-229) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain} stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1g9mh2: