SCOPe 2.08: Domain d1g9mh2: 1g9m H:130-229

Lineage for d1g9mh2 (1g9m H:130-229)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1g9mh2: 1g9m H:130-229 [21263]
   Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh1, d1g9ml1, d1g9ml2
   part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
   complexed with ipa, nag

Details for d1g9mh2

PDB Entry: 1g9m, 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

PDB Compounds: (H:) antibody 17b, heavy chain

SCOPe Domain Sequences for d1g9mh2:

Sequence; same for both SEQRES and ATOM records:

>d1g9mh2 b.1.1.2 (H:130-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1g9mh2:

• d1g9mh2 first appeared (with stable ids) in SCOP 1.55
  
• d1g9mh2 appears in SCOPe 2.07