![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) ![]() |
![]() | Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
![]() | Protein automated matches [226878] (8 species) not a true protein |
![]() | Species Ehrlichia chaffeensis [TaxId:205920] [225805] (1 PDB entry) |
![]() | Domain d3l0gb1: 3l0g B:3-107 [212626] Other proteins in same PDB: d3l0ga2, d3l0gb2, d3l0gc2, d3l0gd2 automated match to d1qapa2 complexed with edo, fmt |
PDB Entry: 3l0g (more details), 2.05 Å
SCOPe Domain Sequences for d3l0gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l0gb1 d.41.2.0 (B:3-107) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} isfseiihnalkedlgdkgdittnsilinekvnfaintrenlvvcgipileevfnmnkeh vkyeihkkdgditgknstlvsgealaiyllpiervilnfiqhasg
Timeline for d3l0gb1: