Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [195722] (2 PDB entries) |
Domain d3l07b2: 3l07 B:121-282 [212623] Other proteins in same PDB: d3l07a1, d3l07b1 automated match to d1b0aa1 complexed with act, edo, imd, po4 |
PDB Entry: 3l07 (more details), 1.88 Å
SCOPe Domain Sequences for d3l07b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l07b2 c.2.1.0 (B:121-282) automated matches {Francisella tularensis [TaxId: 177416]} fhptnvgrlqlrdkkclesctpkgimtmlreygiktegayavvvgasnvvgkpvsqllln akatvttchrfttdlkshttkadilivavgkpnfitadmvkegavvidvginhvdgkivg dvdfaavkdkvaaitpvpggvgpmtitellyntfqcaqelnr
Timeline for d3l07b2: