SCOPe 2.06: Domain d3l07b1: 3l07 B:1-120

Lineage for d3l07b1 (3l07 B:1-120)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (29 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [225804] (1 PDB entry)

8. Domain d3l07b1: 3l07 B:1-120 [212622]
   Other proteins in same PDB: d3l07a2, d3l07a3, d3l07b2, d3l07b3
   automated match to d1b0aa2
   complexed with act, edo, imd, po4

Details for d3l07b1

PDB Entry: 3l07, 1.88 Å

PDB Description: methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis.

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d3l07b1:

Sequence; same for both SEQRES and ATOM records:

>d3l07b1 c.58.1.0 (B:1-120) automated matches {Francisella tularensis [TaxId: 177416]}
milidgkslskdlkerlatqvqeykhhtaitpklvaiivgndpasktyvaskekacaqvg
idsqvitlpehttesellelidqlnndssvhailvqlplpahinknnviysikpekdvdg

Timeline for d3l07b1:

• d3l07b1 first appeared in SCOPe 2.03
  
• d3l07b1 appears in SCOPe 2.05
  
• d3l07b1 appears in SCOPe 2.07
  
• d3l07b1 appears in the current release, SCOPe 2.08