Lineage for d3l07b1 (3l07 B:1-120)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890736Species Francisella tularensis [TaxId:177416] [225804] (1 PDB entry)
  8. 2890738Domain d3l07b1: 3l07 B:1-120 [212622]
    Other proteins in same PDB: d3l07a2, d3l07a3, d3l07b2, d3l07b3
    automated match to d1b0aa2
    complexed with act, edo, imd, po4

Details for d3l07b1

PDB Entry: 3l07 (more details), 1.88 Å

PDB Description: methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis.
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d3l07b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l07b1 c.58.1.0 (B:1-120) automated matches {Francisella tularensis [TaxId: 177416]}
milidgkslskdlkerlatqvqeykhhtaitpklvaiivgndpasktyvaskekacaqvg
idsqvitlpehttesellelidqlnndssvhailvqlplpahinknnviysikpekdvdg

SCOPe Domain Coordinates for d3l07b1:

Click to download the PDB-style file with coordinates for d3l07b1.
(The format of our PDB-style files is described here.)

Timeline for d3l07b1: