![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:177416] [225804] (1 PDB entry) |
![]() | Domain d3l07b1: 3l07 B:1-120 [212622] Other proteins in same PDB: d3l07a2, d3l07a3, d3l07b2, d3l07b3 automated match to d1b0aa2 complexed with act, edo, imd, po4 |
PDB Entry: 3l07 (more details), 1.88 Å
SCOPe Domain Sequences for d3l07b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l07b1 c.58.1.0 (B:1-120) automated matches {Francisella tularensis [TaxId: 177416]} milidgkslskdlkerlatqvqeykhhtaitpklvaiivgndpasktyvaskekacaqvg idsqvitlpehttesellelidqlnndssvhailvqlplpahinknnviysikpekdvdg
Timeline for d3l07b1: