Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d1g9ml2: 1g9m L:110-214 [21262] Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml1 part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120 complexed with ipa, nag, ndg |
PDB Entry: 1g9m (more details), 2.2 Å
SCOPe Domain Sequences for d1g9ml2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ml2 b.1.1.2 (L:110-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqk skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1g9ml2: