Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) |
Family c.55.7.0: automated matches [227260] (1 protein) not a true family |
Protein automated matches [227051] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226038] (3 PDB entries) |
Domain d3l00a1: 3l00 A:5-91 [212618] Other proteins in same PDB: d3l00a2 automated match to d1eh7a2 complexed with zn |
PDB Entry: 3l00 (more details), 1.7 Å
SCOPe Domain Sequences for d3l00a1:
Sequence, based on SEQRES records: (download)
>d3l00a1 c.55.7.0 (A:5-91) automated matches {Human (Homo sapiens) [TaxId: 9606]} cemkrttldsplgklelsgceqglheiiflgkgtsaadavevpapaavlggpeplmqata wlnayfhqpeaieefpvpalhhpvfqq
>d3l00a1 c.55.7.0 (A:5-91) automated matches {Human (Homo sapiens) [TaxId: 9606]} cemkrttldsplgklelsgceqglheiiflgggpeplmqatawlnayfhqpeaieefpvp alhhpvfqq
Timeline for d3l00a1: