SCOPe 2.03: Domain d3l00a1: 3l00 A:5-91

Lineage for d3l00a1 (3l00 A:5-91)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families)

5. Family c.55.7.0: automated matches [227260] (1 protein)
   not a true family

6. Protein automated matches [227051] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226038] (3 PDB entries)

8. Domain d3l00a1: 3l00 A:5-91 [212618]
   Other proteins in same PDB: d3l00a2
   automated match to d1eh7a2
   complexed with zn

Details for d3l00a1

PDB Entry: 3l00, 1.7 Å

PDB Description: Crystal structure of benzylated SNAP-tag

PDB Compounds: (A:) SNAP-tag

SCOPe Domain Sequences for d3l00a1:

Sequence, based on SEQRES records:

>d3l00a1 c.55.7.0 (A:5-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheiiflgkgtsaadavevpapaavlggpeplmqata
wlnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records):

>d3l00a1 c.55.7.0 (A:5-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheiiflgggpeplmqatawlnayfhqpeaieefpvp
alhhpvfqq

Timeline for d3l00a1:

• d3l00a1 is new in SCOPe 2.03-stable
  
• d3l00a1 appears in SCOPe 2.04
  
• d3l00a1 appears in the current release, SCOPe 2.08