![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) ![]() automatically mapped to Pfam PF01035 |
![]() | Family a.4.2.0: automated matches [227261] (1 protein) not a true family |
![]() | Protein automated matches [227052] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226039] (4 PDB entries) |
![]() | Domain d3kzza2: 3kzz A:92-179 [212617] Other proteins in same PDB: d3kzza1 automated match to d1eh6a1 complexed with obg, zn |
PDB Entry: 3kzz (more details), 1.89 Å
SCOPe Domain Sequences for d3kzza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kzza2 a.4.2.0 (A:92-179) automated matches {Human (Homo sapiens) [TaxId: 9606]} esftrqvlwkllkvvkfgevisyshlaalagnpaataavktalsgnpvpilipahrvvqg dldvggyegglavkewllaheghrlgkr
Timeline for d3kzza2: