SCOPe 2.03: Domain d3kzya2: 3kzy A:92-179

Lineage for d3kzya2 (3kzy A:92-179)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families)
   automatically mapped to Pfam PF01035

5. Family a.4.2.0: automated matches [227261] (1 protein)
   not a true family

6. Protein automated matches [227052] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226039] (3 PDB entries)

8. Domain d3kzya2: 3kzy A:92-179 [212613]
   Other proteins in same PDB: d3kzya1, d3kzyb1
   automated match to d1eh6a1
   complexed with zn

Details for d3kzya2

PDB Entry: 3kzy, 1.9 Å

PDB Description: crystal structure of snap-tag

PDB Compounds: (A:) SNAP-tag

SCOPe Domain Sequences for d3kzya2:

Sequence; same for both SEQRES and ATOM records:

>d3kzya2 a.4.2.0 (A:92-179) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyshlaalagnpaataavktalsgnpvpilipchrvvqg
dldvggyegglavkewllaheghrlgkr

Timeline for d3kzya2:

• d3kzya2 is new in SCOPe 2.03-stable
  
• d3kzya2 appears in SCOPe 2.04
  
• d3kzya2 appears in the current release, SCOPe 2.08