Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) automatically mapped to Pfam PF01035 |
Family a.4.2.0: automated matches [227261] (1 protein) not a true family |
Protein automated matches [227052] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226039] (3 PDB entries) |
Domain d3kzya2: 3kzy A:92-179 [212613] Other proteins in same PDB: d3kzya1, d3kzyb1 automated match to d1eh6a1 complexed with zn |
PDB Entry: 3kzy (more details), 1.9 Å
SCOPe Domain Sequences for d3kzya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kzya2 a.4.2.0 (A:92-179) automated matches {Human (Homo sapiens) [TaxId: 9606]} esftrqvlwkllkvvkfgevisyshlaalagnpaataavktalsgnpvpilipchrvvqg dldvggyegglavkewllaheghrlgkr
Timeline for d3kzya2: