Lineage for d3kzya2 (3kzy A:92-179)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692898Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) (S)
    automatically mapped to Pfam PF01035
  5. 2692917Family a.4.2.0: automated matches [227261] (1 protein)
    not a true family
  6. 2692918Protein automated matches [227052] (1 species)
    not a true protein
  7. 2692919Species Human (Homo sapiens) [TaxId:9606] [226039] (4 PDB entries)
  8. 2692922Domain d3kzya2: 3kzy A:92-179 [212613]
    Other proteins in same PDB: d3kzya1, d3kzyb1
    automated match to d1eh6a1
    complexed with zn

Details for d3kzya2

PDB Entry: 3kzy (more details), 1.9 Å

PDB Description: crystal structure of snap-tag
PDB Compounds: (A:) SNAP-tag

SCOPe Domain Sequences for d3kzya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kzya2 a.4.2.0 (A:92-179) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyshlaalagnpaataavktalsgnpvpilipchrvvqg
dldvggyegglavkewllaheghrlgkr

SCOPe Domain Coordinates for d3kzya2:

Click to download the PDB-style file with coordinates for d3kzya2.
(The format of our PDB-style files is described here.)

Timeline for d3kzya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kzya1