![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
![]() | Species Fab Mab1-IA (mouse), kappa L chain [49064] (1 PDB entry) neutralizes human rhinovirus 14 |
![]() | Domain d1a6td2: 1a6t D:114-213 [21261] Other proteins in same PDB: d1a6ta1, d1a6tb1, d1a6tc1, d1a6td1 |
PDB Entry: 1a6t (more details), 2.7 Å
SCOP Domain Sequences for d1a6td2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6td2 b.1.1.2 (D:114-213) Immunoglobulin (constant domains of L and H chains) {Fab Mab1-IA (mouse), kappa L chain} akttppsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsg lytlsssvtvtsstwpsqtitcnvahpasstkvdkkiepr
Timeline for d1a6td2: