SCOP 1.63: Domain d1a6td2: 1a6t D:114-213

Lineage for d1a6td2 (1a6t D:114-213)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
Species Fab Mab1-IA (mouse), kappa L chain [49064] (1 PDB entry)
neutralizes human rhinovirus 14
Domain d1a6td2: 1a6t D:114-213 [21261]
Other proteins in same PDB: d1a6ta1, d1a6tb1, d1a6tc1, d1a6td1

Details for d1a6td2

PDB Entry: 1a6t (more details), 2.7 Å

PDB Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site

SCOP Domain Sequences for d1a6td2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6td2 b.1.1.2 (D:114-213) Immunoglobulin (constant domains of L and H chains) {Fab Mab1-IA (mouse), kappa L chain}
akttppsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsg
lytlsssvtvtsstwpsqtitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1a6td2:

Click to download the PDB-style file with coordinates for d1a6td2.
(The format of our PDB-style files is described here.)

Timeline for d1a6td2: