SCOPe 2.05: Domain d3kz3b_: 3kz3 B:

Lineage for d3kz3b_ (3kz3 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [47421] (5 PDB entries)

8. Domain d3kz3b_: 3kz3 B: [212605]
   automated match to d1lrpa_
   mutant

Details for d3kz3b_

PDB Entry: 3kz3, 1.64 Å

PDB Description: a structure of a lambda repressor fragment mutant

PDB Compounds: (B:) repressor protein ci

SCOPe Domain Sequences for d3kz3b_:

Sequence; same for both SEQRES and ATOM records:

>d3kz3b_ a.35.1.2 (B:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
sltqeqledarrlkaiwekkknelglsyesvadkmgmgqsavaalfnginalnaynaall
akilkvsveefspsiareir

Timeline for d3kz3b_:

• d3kz3b_ first appeared in SCOPe 2.03
  
• d3kz3b_ appears in SCOPe 2.04
  
• d3kz3b_ appears in SCOPe 2.06
  
• d3kz3b_ appears in the current release, SCOPe 2.08