Lineage for d1a6tc2 (1a6t C:108-211)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53866Species Fab Mab1-IA (mouse), kappa L chain [49064] (1 PDB entry)
  8. 53869Domain d1a6tc2: 1a6t C:108-211 [21260]
    Other proteins in same PDB: d1a6ta1, d1a6tb1, d1a6tc1, d1a6td1

Details for d1a6tc2

PDB Entry: 1a6t (more details), 2.7 Å

PDB Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site

SCOP Domain Sequences for d1a6tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6tc2 b.1.1.2 (C:108-211) Immunoglobulin (constant domains of L and H chains) {Fab Mab1-IA (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1a6tc2:

Click to download the PDB-style file with coordinates for d1a6tc2.
(The format of our PDB-style files is described here.)

Timeline for d1a6tc2: