Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
Domain d3kymk2: 3kym K:108-212 [212599] Other proteins in same PDB: d3kyma1, d3kymc1, d3kyme1, d3kymg1, d3kymi1, d3kymk1, d3kymm1, d3kymo1 automated match to d1rhha2 |
PDB Entry: 3kym (more details), 2.62 Å
SCOPe Domain Sequences for d3kymk2:
Sequence, based on SEQRES records: (download)
>d3kymk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
>d3kymk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfpsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskd styslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d3kymk2: