Lineage for d3kymg1 (3kym G:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758579Domain d3kymg1: 3kym G:1-107 [212594]
    Other proteins in same PDB: d3kyma2, d3kymc2, d3kyme2, d3kymg2, d3kymi2, d3kymj_, d3kymk2, d3kyml_, d3kymm2, d3kymn_, d3kymo2, d3kymp_
    automated match to d1rhha1

Details for d3kymg1

PDB Entry: 3kym (more details), 2.62 Å

PDB Description: Crystal structure of Li33 IgG2 di-Fab
PDB Compounds: (G:) Light Chain Li33 IgG2

SCOPe Domain Sequences for d3kymg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kymg1 b.1.1.0 (G:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveik

SCOPe Domain Coordinates for d3kymg1:

Click to download the PDB-style file with coordinates for d3kymg1.
(The format of our PDB-style files is described here.)

Timeline for d3kymg1: