Lineage for d3kyme1 (3kym E:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766364Domain d3kyme1: 3kym E:1-107 [212592]
    Other proteins in same PDB: d3kyma2, d3kymc2, d3kyme2, d3kymg2, d3kymi2, d3kymk2, d3kymm2, d3kymo2
    automated match to d1rhha1

Details for d3kyme1

PDB Entry: 3kym (more details), 2.62 Å

PDB Description: Crystal structure of Li33 IgG2 di-Fab
PDB Compounds: (E:) Light Chain Li33 IgG2

SCOPe Domain Sequences for d3kyme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kyme1 b.1.1.0 (E:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveik

SCOPe Domain Coordinates for d3kyme1:

Click to download the PDB-style file with coordinates for d3kyme1.
(The format of our PDB-style files is described here.)

Timeline for d3kyme1: