SCOPe 2.08: Domain d3kyma1: 3kym A:1-107

Lineage for d3kyma1 (3kym A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3kyma1: 3kym A:1-107 [212588]
   Other proteins in same PDB: d3kyma2, d3kymc2, d3kyme2, d3kymg2, d3kymi2, d3kymj_, d3kymk2, d3kyml_, d3kymm2, d3kymn_, d3kymo2, d3kymp_
   automated match to d1rhha1

Details for d3kyma1

PDB Entry: 3kym, 2.62 Å

PDB Description: Crystal structure of Li33 IgG2 di-Fab

PDB Compounds: (A:) Light Chain Li33 IgG2

SCOPe Domain Sequences for d3kyma1:

Sequence; same for both SEQRES and ATOM records:

>d3kyma1 b.1.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveik

Timeline for d3kyma1:

• d3kyma1 first appeared in SCOPe 2.03
  
• d3kyma1 appears in SCOPe 2.07