SCOPe 2.07: Domain d3kyjb1: 3kyj B:2-134

Lineage for d3kyjb1 (3kyj B:2-134)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [225833] (2 PDB entries)

8. Domain d3kyjb1: 3kyj B:2-134 [212587]
   Other proteins in same PDB: d3kyjb2
   automated match to d3c3ma_
   complexed with na

Details for d3kyjb1

PDB Entry: 3kyj, 1.4 Å

PDB Description: crystal structure of the p1 domain of chea3 in complex with chey6 from r. sphaeroides

PDB Compounds: (B:) CheY6 protein

SCOPe Domain Sequences for d3kyjb1:

Sequence, based on SEQRES records:

>d3kyjb1 c.23.1.0 (B:2-134) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
pynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlilldiempv
mdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakpsgtvshdleektg
gelartmrtlmaa

Sequence, based on observed residues (ATOM records):

>d3kyjb1 c.23.1.0 (B:2-134) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
pynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlilldiempv
mdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakpsgtvktggelart
mrtlmaa

Timeline for d3kyjb1:

• d3kyjb1 first appeared in SCOPe 2.03, called d3kyjb_
  
• d3kyjb1 appears in SCOPe 2.06
  
• d3kyjb1 appears in the current release, SCOPe 2.08