Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [225833] (2 PDB entries) |
Domain d3kyjb1: 3kyj B:2-134 [212587] Other proteins in same PDB: d3kyjb2 automated match to d3c3ma_ complexed with na |
PDB Entry: 3kyj (more details), 1.4 Å
SCOPe Domain Sequences for d3kyjb1:
Sequence, based on SEQRES records: (download)
>d3kyjb1 c.23.1.0 (B:2-134) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} pynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlilldiempv mdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakpsgtvshdleektg gelartmrtlmaa
>d3kyjb1 c.23.1.0 (B:2-134) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} pynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlilldiempv mdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakpsgtvktggelart mrtlmaa
Timeline for d3kyjb1: