Lineage for d3kyib1 (3kyi B:2-134)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856098Species Rhodobacter sphaeroides [TaxId:1063] [225833] (2 PDB entries)
  8. 2856100Domain d3kyib1: 3kyi B:2-134 [212586]
    Other proteins in same PDB: d3kyib2
    automated match to d3c3ma_

Details for d3kyib1

PDB Entry: 3kyi (more details), 2.8 Å

PDB Description: crystal structure of the phosphorylated p1 domain of chea3 in complex with chey6 from r. sphaeroides
PDB Compounds: (B:) CheY6 protein

SCOPe Domain Sequences for d3kyib1:

Sequence, based on SEQRES records: (download)

>d3kyib1 c.23.1.0 (B:2-134) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
pynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlillniempv
mdgmeflrhaklktrakicmlasvavsgsphaararelgadgvvakpsgtvshdleektg
gelartmrtlmaa

Sequence, based on observed residues (ATOM records): (download)

>d3kyib1 c.23.1.0 (B:2-134) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
pynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlillniemef
lrhaklktrakicmlaselgadgvvakpsggelartmrtlmaa

SCOPe Domain Coordinates for d3kyib1:

Click to download the PDB-style file with coordinates for d3kyib1.
(The format of our PDB-style files is described here.)

Timeline for d3kyib1: