SCOPe 2.05: Domain d3kygb2: 3kyg B:138-247

Lineage for d3kygb2 (3kyg B:138-247)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.2: PilZ domain-like [141371] (2 families)

5. Family b.45.2.1: PilZ domain [141372] (3 proteins)
   Pfam PF07238

6. Protein automated matches [227036] (1 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [225874] (1 PDB entry)

8. Domain d3kygb2: 3kyg B:138-247 [212585]
   Other proteins in same PDB: d3kyga1, d3kygb1
   automated match to d1ylna1
   complexed with 5gp

Details for d3kygb2

PDB Entry: 3kyg, 2.1 Å

PDB Description: crystal structure of vca0042 (l135r) complexed with c-di-gmp

PDB Compounds: (B:) Putative uncharacterized protein VCA0042

SCOPe Domain Sequences for d3kygb2:

Sequence; same for both SEQRES and ATOM records:

>d3kygb2 b.45.2.1 (B:138-247) automated matches {Vibrio cholerae [TaxId: 666]}
eprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtk
tfppltgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltln

Timeline for d3kygb2:

• d3kygb2 first appeared in SCOPe 2.03
  
• d3kygb2 appears in SCOPe 2.04
  
• d3kygb2 appears in SCOPe 2.06
  
• d3kygb2 appears in the current release, SCOPe 2.08