Lineage for d3kyga2 (3kyg A:138-247)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794466Superfamily b.45.2: PilZ domain-like [141371] (2 families) (S)
  5. 2794467Family b.45.2.1: PilZ domain [141372] (3 proteins)
    Pfam PF07238
  6. 2794481Protein automated matches [227036] (1 species)
    not a true protein
  7. 2794482Species Vibrio cholerae [TaxId:666] [225874] (1 PDB entry)
  8. 2794483Domain d3kyga2: 3kyg A:138-247 [212583]
    Other proteins in same PDB: d3kyga1, d3kygb1
    automated match to d1ylna1
    complexed with 5gp

Details for d3kyga2

PDB Entry: 3kyg (more details), 2.1 Å

PDB Description: crystal structure of vca0042 (l135r) complexed with c-di-gmp
PDB Compounds: (A:) Putative uncharacterized protein VCA0042

SCOPe Domain Sequences for d3kyga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kyga2 b.45.2.1 (A:138-247) automated matches {Vibrio cholerae [TaxId: 666]}
eprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtk
tfppltgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltln

SCOPe Domain Coordinates for d3kyga2:

Click to download the PDB-style file with coordinates for d3kyga2.
(The format of our PDB-style files is described here.)

Timeline for d3kyga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kyga1