Lineage for d3kxua_ (3kxu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2701031Species Human (Homo sapiens) [TaxId:9606] [187702] (9 PDB entries)
  8. 2701032Domain d3kxua_: 3kxu A: [212581]
    automated match to d2fg4a_
    complexed with cd, so4; mutant

Details for d3kxua_

PDB Entry: 3kxu (more details), 1.85 Å

PDB Description: Crystal structure of human ferritin FTL498InsTC pathogenic mutant
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d3kxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kxua_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
tdphlcdflethfldeevklikkmgdhltnlhrlgg

SCOPe Domain Coordinates for d3kxua_:

Click to download the PDB-style file with coordinates for d3kxua_.
(The format of our PDB-style files is described here.)

Timeline for d3kxua_: