Lineage for d3kx6d_ (3kx6 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086523Species Babesia bovis [TaxId:5865] [225802] (1 PDB entry)
  8. 2086527Domain d3kx6d_: 3kx6 D: [212573]
    automated match to d2qapa1
    complexed with cit, edo, peg

Details for d3kx6d_

PDB Entry: 3kx6 (more details), 2.1 Å

PDB Description: Crystal structure of fructose-1,6-bisphosphate aldolase from Babesia bovis at 2.1A resolution
PDB Compounds: (D:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3kx6d_:

Sequence, based on SEQRES records: (download)

>d3kx6d_ c.1.10.0 (D:) automated matches {Babesia bovis [TaxId: 5865]}
klsqerakelaenasfiaspgkgilaadestgtiqkrfdnvgventeknraeyrsilftt
kglgkyisgcilfeetlfqqapngqnmvdllraegilpgikvdkglvtipntdeevsttg
ldglaercqkyynagarfakwravlsidvkknkpsnlsiletahtlaryaaicqenglvp
ivepeiladgdhsievcaevtervlaavfkalndhkvllegallkpnmvtqgvdckdkpa
pqtvgfltsralrrtvppalpgvmflsggqsesmatrhlneinkcnkhpwslsfsygral
qssvlktwngsmsnaaaaqdvlmklaqqnseaslgslktdlsddgeslfeakyiy

Sequence, based on observed residues (ATOM records): (download)

>d3kx6d_ c.1.10.0 (D:) automated matches {Babesia bovis [TaxId: 5865]}
klsqerakelaenasfiaspgkgilaadestgtiqkrfdnvgventeknraeyrsilftt
kglgkyisgcilfeetlfqqapngqnmvdllraegilpgikvdkglvtipntdeevsttg
ldglaercqkyynagarfakwravlsidvkknkpsnlsiletahtlaryaaicqenglvp
ivepeiladgdhsievcaevtervlaavfkalndhkvllegallkpnmvtqgvdckdkpa
pqtvgfltsralrrtvppalpgvmflsggqsesmatrhlneinkcnkhpwslsfsygral
qssvlktwngsmsnaaaaqdvlmklaqqnseaslgslkakyiy

SCOPe Domain Coordinates for d3kx6d_:

Click to download the PDB-style file with coordinates for d3kx6d_.
(The format of our PDB-style files is described here.)

Timeline for d3kx6d_: