![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries) |
![]() | Domain d1bgxh2: 1bgx H:116-209 [21257] Other proteins in same PDB: d1bgxh1, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4 part of Fab TP7 against Taq DNA polymerase |
PDB Entry: 1bgx (more details), 2.3 Å
SCOP Domain Sequences for d1bgxh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bgxh2 b.1.1.2 (H:116-209) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss svtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1bgxh2: