SCOPe 2.08: Domain d3ktxb2: 3ktx B:88-186

Lineage for d3ktxb2 (3ktx B:88-186)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
   this domain interrupts beta/alpha-barrel domain
   C-terminal domain is alpha/beta

6. Protein Pyruvate kinase (PK) [50802] (6 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries)

8. Domain d3ktxb2: 3ktx B:88-186 [212548]
   Other proteins in same PDB: d3ktxa1, d3ktxa3, d3ktxb1, d3ktxb3
   automated match to d1pkla1
   complexed with gol, ptk

Details for d3ktxb2

PDB Entry: 3ktx, 2.1 Å

PDB Description: Crystal structure of Leishmania mexicana pyruvate kinase (LmPYK)in complex with 1,3,6,8-pyrenetetrasulfonic acid

PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d3ktxb2:

Sequence; same for both SEQRES and ATOM records:

>d3ktxb2 b.58.1.1 (B:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

Timeline for d3ktxb2:

• d3ktxb2 first appeared in SCOPe 2.03
  
• d3ktxb2 appears in SCOPe 2.07