Lineage for d3ktxb1 (3ktx B:1-87,B:187-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2837914Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2837915Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2838018Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51626] (11 PDB entries)
  8. 2838022Domain d3ktxb1: 3ktx B:1-87,B:187-357 [212547]
    Other proteins in same PDB: d3ktxa2, d3ktxa3, d3ktxb2, d3ktxb3
    automated match to d1pkla2
    complexed with gol, ptk

Details for d3ktxb1

PDB Entry: 3ktx (more details), 2.1 Å

PDB Description: Crystal structure of Leishmania mexicana pyruvate kinase (LmPYK)in complex with 1,3,6,8-pyrenetetrasulfonic acid
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d3ktxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktxb1 c.1.12.1 (B:1-87,B:187-357) Pyruvate kinase, N-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
qttinnvrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsaeq
vgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaq
kiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgky
pnevvqymaricleaqsal

SCOPe Domain Coordinates for d3ktxb1:

Click to download the PDB-style file with coordinates for d3ktxb1.
(The format of our PDB-style files is described here.)

Timeline for d3ktxb1: