Lineage for d3ktxa2 (3ktx A:88-186)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799609Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1799610Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 1799611Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 1799612Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 1799700Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries)
  8. 1799703Domain d3ktxa2: 3ktx A:88-186 [212545]
    Other proteins in same PDB: d3ktxa1, d3ktxa3, d3ktxb1, d3ktxb3
    automated match to d1pkla1
    complexed with gol, ptk

Details for d3ktxa2

PDB Entry: 3ktx (more details), 2.1 Å

PDB Description: Crystal structure of Leishmania mexicana pyruvate kinase (LmPYK)in complex with 1,3,6,8-pyrenetetrasulfonic acid
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d3ktxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktxa2 b.58.1.1 (A:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

SCOPe Domain Coordinates for d3ktxa2:

Click to download the PDB-style file with coordinates for d3ktxa2.
(The format of our PDB-style files is described here.)

Timeline for d3ktxa2: