Lineage for d3ktna1 (3ktn A:2-336)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904686Species Enterococcus faecalis [TaxId:1351] [186955] (2 PDB entries)
  8. 2904688Domain d3ktna1: 3ktn A:2-336 [212543]
    Other proteins in same PDB: d3ktna2, d3ktna3
    automated match to d2afbb_
    complexed with mg, so4

Details for d3ktna1

PDB Entry: 3ktn (more details), 2.26 Å

PDB Description: crystal structure of a putative 2-keto-3-deoxygluconate kinase from enterococcus faecalis
PDB Compounds: (A:) Carbohydrate kinase, PfkB family

SCOPe Domain Sequences for d3ktna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktna1 c.72.1.0 (A:2-336) automated matches {Enterococcus faecalis [TaxId: 1351]}
kiaafgevmlrftppeylmleqteqlrmnfvgtgvnllanlahfqletalitklpanrlg
eagkaalrklgisdqwvgekgdhigsffaemgygirptqvtyqnrhqsafgiseakdydf
eaflaevdmvhicgislsltektrdaalilaqkahayqkkvcfdfnyrpslntansalfm
rqqyerilpycdivfgsrrdlvellgfipredlegeaqeteliqrfmsqynlewfagttr
shsqnqnylsgylytqneyqqsekrpllnldrigagdayaagilygysqnwslekavtfa
tvngvlahtiqgdiplttvkqvnhvlehpnidlir

SCOPe Domain Coordinates for d3ktna1:

Click to download the PDB-style file with coordinates for d3ktna1.
(The format of our PDB-style files is described here.)

Timeline for d3ktna1: