SCOPe 2.03: Domain d3ktla2: 3ktl A:81-222

Lineage for d3ktla2 (3ktl A:81-222)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (28 PDB entries)
   Uniprot P08263

8. Domain d3ktla2: 3ktl A:81-222 [212540]
   Other proteins in same PDB: d3ktla1, d3ktlb1
   automated match to d1agsa1
   complexed with gtx; mutant

Details for d3ktla2

PDB Entry: 3ktl, 1.75 Å

PDB Description: crystal structure of an i71a human gsta1-1 mutant in complex with s- hexylglutathione

PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d3ktla2:

Sequence; same for both SEQRES and ATOM records:

>d3ktla2 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d3ktla2:

• d3ktla2 is new in SCOPe 2.03-stable
  
• d3ktla2 appears in SCOPe 2.04
  
• d3ktla2 appears in the current release, SCOPe 2.08