Lineage for d3ksua_ (3ksu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095548Species Oenococcus oeni [TaxId:203123] [225800] (1 PDB entry)
  8. 2095549Domain d3ksua_: 3ksu A: [212537]
    automated match to d2o23b_

Details for d3ksua_

PDB Entry: 3ksu (more details), 2.3 Å

PDB Description: Crystal structure of short-chain dehydrogenase from oenococcus oeni psu-1
PDB Compounds: (A:) 3-oxoacyl-acyl carrier protein reductase

SCOPe Domain Sequences for d3ksua_:

Sequence, based on SEQRES records: (download)

>d3ksua_ c.2.1.0 (A:) automated matches {Oenococcus oeni [TaxId: 203123]}
tkyhdlknkviviaggiknlgaltaktfalesvnlvlhyhqakdsdtanklkdeledqga
kvalyqsdlsneeevaklfdfaekefgkvdiaintvgkvlkkpivetseaefdamdtinn
kvayffikqaakhmnpnghiitiatsllaaytgfystyagnkapvehytraaskelmkqq
isvnaiapgpmdtsffygqetkestafhksqamgnqltkiediapiikflttdgwwingq
tifanggyttr

Sequence, based on observed residues (ATOM records): (download)

>d3ksua_ c.2.1.0 (A:) automated matches {Oenococcus oeni [TaxId: 203123]}
tkyhdlknkviviaggiknlgaltaktfalesvnlvlhyhqakdsdtanklkdeledqga
kvalyqsdlsneeevaklfdfaekefgkvdiaintvgkvlkkpivetseaefdamdtinn
kvayffikqaakhmnpnghiitiatsllaaytgfystapvehytraaskelmkqqisvna
iapgpmdtsffygqemgnqltkiediapiikflttdgwwingqtifanggyttr

SCOPe Domain Coordinates for d3ksua_:

Click to download the PDB-style file with coordinates for d3ksua_.
(The format of our PDB-style files is described here.)

Timeline for d3ksua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ksub_