SCOPe 2.07: Domain d3ksqb_: 3ksq B:

Lineage for d3ksqb_ (3ksq B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
   Uniprot Q02293 22-418 P53610

8. Domain d3ksqb_: 3ksq B: [212536]
   Other proteins in same PDB: d3ksqa_
   automated match to d1d8db_
   complexed with fpp, mg, z96, zn

Details for d3ksqb_

PDB Entry: 3ksq, 2.1 Å

PDB Description: Discovery of C-Imidazole Azaheptapyridine FPT Inhibitors

PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d3ksqb_:

Sequence; same for both SEQRES and ATOM records:

>d3ksqb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggf
gggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d3ksqb_:

• d3ksqb_ first appeared in SCOPe 2.03
  
• d3ksqb_ appears in SCOPe 2.06
  
• d3ksqb_ appears in the current release, SCOPe 2.08