Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (49 PDB entries) Uniprot Q02293 22-418 P53610 |
Domain d3ksqb_: 3ksq B: [212536] Other proteins in same PDB: d3ksqa_ automated match to d1d8db_ complexed with fpp, mg, z96, zn |
PDB Entry: 3ksq (more details), 2.1 Å
SCOPe Domain Sequences for d3ksqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ksqb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]} eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggf gggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
Timeline for d3ksqb_: