SCOP 1.73: Domain d1a3lh2: 1a3l H:114-227

Lineage for d1a3lh2 (1a3l H:114-227)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1a3lh2: 1a3l H:114-227 [21253]
   Other proteins in same PDB: d1a3lh1, d1a3ll1, d1a3ll2
   part of Diels-Alder catalytic Fab 13G5
   complexed with cfc

Details for d1a3lh2

PDB Entry: 1a3l, 1.95 Å

PDB Description: catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution

PDB Compounds: (H:) immunoglobulin fab 13g5 (heavy chain)

SCOP Domain Sequences for d1a3lh2:

Sequence; same for both SEQRES and ATOM records:

>d1a3lh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d1a3lh2:

• d1a3lh2 first appeared (with stable ids) in SCOP 1.55
  
• d1a3lh2 appears in SCOP 1.71
  
• d1a3lh2 appears in SCOP 1.75
  
• d1a3lh2 appears in the current release, SCOPe 2.08