SCOP 1.55: Domain d1a3lh2: 1a3l H:114-227

Lineage for d1a3lh2 (1a3l H:114-227)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Diels alder catalytic Fab 13G5 (mouse), kappa L chain [49062] (1 PDB entry)

8. Domain d1a3lh2: 1a3l H:114-227 [21253]
   Other proteins in same PDB: d1a3lh1, d1a3ll1

Details for d1a3lh2

PDB Entry: 1a3l, 1.95 Å

PDB Description: catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution

SCOP Domain Sequences for d1a3lh2:

Sequence; same for both SEQRES and ATOM records:

>d1a3lh2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Diels alder catalytic Fab 13G5 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d1a3lh2:

• d1a3lh2 appears in SCOP 1.57
  
• d1a3lh2 appears in the current release, SCOPe 2.08