SCOPe 2.08: Domain d3ks0j1: 3ks0 J:1-110

Lineage for d3ks0j1 (3ks0 J:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3ks0j1: 3ks0 J:1-110 [212529]
   Other proteins in same PDB: d3ks0a_, d3ks0b_, d3ks0h_, d3ks0k_
   automated match to d1aqkl1
   complexed with hem

Details for d3ks0j1

PDB Entry: 3ks0, 2.7 Å

PDB Description: crystal structure of the heme domain of flavocytochrome b2 in complex with fab b2b4

PDB Compounds: (J:) heme domain of flavocytochrome b2

SCOPe Domain Sequences for d3ks0j1:

Sequence; same for both SEQRES and ATOM records:

>d3ks0j1 b.1.1.0 (J:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnkrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwdsnhlvfgggtkltvlg

Timeline for d3ks0j1:

• d3ks0j1 first appeared in SCOPe 2.03
  
• d3ks0j1 appears in SCOPe 2.07