Lineage for d3ks0a_ (3ks0 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429571Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 1429572Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 1429673Family d.120.1.0: automated matches [191500] (1 protein)
    not a true family
  6. 1429674Protein automated matches [190822] (4 species)
    not a true protein
  7. 1429675Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225894] (1 PDB entry)
  8. 1429676Domain d3ks0a_: 3ks0 A: [212527]
    Other proteins in same PDB: d3ks0j1, d3ks0j2, d3ks0l1, d3ks0l2
    automated match to d2ibja_
    complexed with hem

Details for d3ks0a_

PDB Entry: 3ks0 (more details), 2.7 Å

PDB Description: crystal structure of the heme domain of flavocytochrome b2 in complex with fab b2b4
PDB Compounds: (A:) Cytochrome b2, mitochondrial

SCOPe Domain Sequences for d3ks0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ks0a_ d.120.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
hapnvidkyiapekklgplqgsmppelvcppy

SCOPe Domain Coordinates for d3ks0a_:

Click to download the PDB-style file with coordinates for d3ks0a_.
(The format of our PDB-style files is described here.)

Timeline for d3ks0a_: