| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) ![]() |
| Family d.120.1.0: automated matches [191500] (1 protein) not a true family |
| Protein automated matches [190822] (4 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225894] (1 PDB entry) |
| Domain d3ks0a_: 3ks0 A: [212527] Other proteins in same PDB: d3ks0j1, d3ks0j2, d3ks0l1, d3ks0l2 automated match to d2ibja_ complexed with hem |
PDB Entry: 3ks0 (more details), 2.7 Å
SCOPe Domain Sequences for d3ks0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ks0a_ d.120.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
hapnvidkyiapekklgplqgsmppelvcppy
Timeline for d3ks0a_: