Lineage for d3krsa_ (3krs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2078942Species Cryptosporidium parvum [TaxId:353152] [225799] (1 PDB entry)
  8. 2078943Domain d3krsa_: 3krs A: [212525]
    automated match to d3uwva_
    complexed with na, unx

Details for d3krsa_

PDB Entry: 3krs (more details), 1.55 Å

PDB Description: Structure of Triosephosphate Isomerase from Cryptosporidium Parvum at 1.55A Resolution
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d3krsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3krsa_ c.1.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
srkyfvggnfkcngtkeslktlidsfkqvessnsevyvfptslhislvkeffgndhpgvf
kigsqnisctgngaftgevscemlkdmdvdcslvghserrqyysetdqivnnkvkkglen
glkivlcigeslseretgktndviqkqltealkdvsdlsnlviayepiwaigtgvvatpg
qaqeahafireyvtrmynpqvssnlriiyggsvtpdncnelikcadidgflvggaslkpt
fakiiesaq

SCOPe Domain Coordinates for d3krsa_:

Click to download the PDB-style file with coordinates for d3krsa_.
(The format of our PDB-style files is described here.)

Timeline for d3krsa_: