SCOPe 2.05: Domain d3krfd_: 3krf D:

Lineage for d3krfd_ (3krf D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (30 species)
   not a true protein

7. Species Mentha x [TaxId:34256] [196410] (7 PDB entries)

8. Domain d3krfd_: 3krf D: [212520]
   automated match to d3oacd_
   complexed with dst, edo, ipe, mg, ppv

Details for d3krfd_

PDB Entry: 3krf, 2.2 Å

PDB Description: mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (i)

PDB Compounds: (D:) Geranyl diphosphate synthase large subunit

SCOPe Domain Sequences for d3krfd_:

Sequence; same for both SEQRES and ATOM records:

>d3krfd_ a.128.1.0 (D:) automated matches {Mentha x [TaxId: 34256]}
mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn

Timeline for d3krfd_:

• d3krfd_ first appeared in SCOPe 2.03
  
• d3krfd_ appears in SCOPe 2.04
  
• d3krfd_ is called d3krfd1 in SCOPe 2.06
  
• d3krfd_ appears in the current release, SCOPe 2.08, called d3krfd1