Lineage for d3krfd1 (3krf D:2-295)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2731968Species Mentha x [TaxId:34256] [196410] (7 PDB entries)
  8. 2731974Domain d3krfd1: 3krf D:2-295 [212520]
    Other proteins in same PDB: d3krfa2, d3krfd2
    automated match to d3oacd_
    complexed with dst, edo, ipe, mg, ppv

Details for d3krfd1

PDB Entry: 3krf (more details), 2.2 Å

PDB Description: mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (i)
PDB Compounds: (D:) Geranyl diphosphate synthase large subunit

SCOPe Domain Sequences for d3krfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3krfd1 a.128.1.0 (D:2-295) automated matches {Mentha x [TaxId: 34256]}
fdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvggd
estampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfaf
ehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhkt
aallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkdl
vadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn

SCOPe Domain Coordinates for d3krfd1:

Click to download the PDB-style file with coordinates for d3krfd1.
(The format of our PDB-style files is described here.)

Timeline for d3krfd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3krfd2