SCOPe 2.05: Domain d3kquf1: 3kqu F:189-325

Lineage for d3kquf1 (3kqu F:189-325)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (17 PDB entries)

8. Domain d3kquf1: 3kqu F:189-325 [212513]
   automated match to d1heia1
   protein/DNA complex; complexed with adp, bef, mn

Details for d3kquf1

PDB Entry: 3kqu, 2.4 Å

PDB Description: three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism

PDB Compounds: (F:) Serine protease/NTPase/helicase NS3

SCOPe Domain Sequences for d3kquf1:

Sequence; same for both SEQRES and ATOM records:

>d3kquf1 c.37.1.14 (F:189-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
qaetagarlvvlatatp

Timeline for d3kquf1:

• d3kquf1 first appeared in SCOPe 2.03
  
• d3kquf1 appears in SCOPe 2.04
  
• d3kquf1 appears in SCOPe 2.06
  
• d3kquf1 appears in the current release, SCOPe 2.08