| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.14: RNA helicase [52724] (7 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
| Protein HCV helicase domain, C-terminal domain [418963] (1 species) |
| Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419425] (15 PDB entries) |
| Domain d3kque2: 3kqu E:326-624 [212512] Other proteins in same PDB: d3kqua1, d3kqua3, d3kqub1, d3kqub3, d3kquc1, d3kquc3, d3kqud1, d3kqud3, d3kque1, d3kque3, d3kquf1, d3kquf3 automated match to d1heia2 protein/DNA complex; complexed with adp, bef, mn has additional subdomain(s) that are not in the common domain |
PDB Entry: 3kqu (more details), 2.4 Å
SCOPe Domain Sequences for d3kque2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kque2 c.37.1.14 (E:326-624) HCV helicase domain, C-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvphpnieevalsstgeipfygkaipietikggrhlifchskkkcdelaaklsglg
lnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevttthpitkyimacms
Timeline for d3kque2: