SCOP 1.61: Domain d1c1eh2: 1c1e H:120-228

Lineage for d1c1eh2 (1c1e H:120-228)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Diels-Alder catalytic Fab 1E9 (mouse), kappa L chain [49061] (1 PDB entry)

8. Domain d1c1eh2: 1c1e H:120-228 [21251]
   Other proteins in same PDB: d1c1eh1, d1c1el1

Details for d1c1eh2

PDB Entry: 1c1e, 1.9 Å

PDB Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten

SCOP Domain Sequences for d1c1eh2:

Sequence; same for both SEQRES and ATOM records:

>d1c1eh2 b.1.1.2 (H:120-228) Immunoglobulin (constant domains of L and H chains) {Diels-Alder catalytic Fab 1E9 (mouse), kappa L chain}
svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpssprpsetvtcnvahpasstkvdkkivpr

Timeline for d1c1eh2:

• d1c1eh2 first appeared (with stable ids) in SCOP 1.55
  
• d1c1eh2 appears in SCOP 1.59
  
• d1c1eh2 appears in SCOP 1.63
  
• d1c1eh2 appears in the current release, SCOPe 2.08