SCOPe 2.08: Domain d3kqla1: 3kql A:189-325

Lineage for d3kqla1 (3kql A:189-325)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain, N-terminal domain [418962] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419424] (17 PDB entries)

8. Domain d3kqla1: 3kql A:189-325 [212497]
   Other proteins in same PDB: d3kqla2, d3kqla3, d3kqlb2, d3kqlb3
   automated match to d1heia1
   protein/DNA complex; complexed with adp, alf, mg

Details for d3kqla1

PDB Entry: 3kql, 2.5 Å

PDB Description: three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism

PDB Compounds: (A:) Serine protease/NTPase/helicase NS3

SCOPe Domain Sequences for d3kqla1:

Sequence; same for both SEQRES and ATOM records:

>d3kqla1 c.37.1.14 (A:189-325) HCV helicase domain, N-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
qaetagarlvvlatatp

Timeline for d3kqla1:

• d3kqla1 first appeared in SCOPe 2.03
  
• d3kqla1 appears in SCOPe 2.07