Lineage for d3kqkb1 (3kqk B:189-325)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870435Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2870478Protein HCV helicase domain, N-terminal domain [418962] (1 species)
  7. 2870479Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419424] (17 PDB entries)
  8. 2870509Domain d3kqkb1: 3kqk B:189-325 [212495]
    Other proteins in same PDB: d3kqka2, d3kqkb2
    automated match to d1heia1
    protein/DNA complex

Details for d3kqkb1

PDB Entry: 3kqk (more details), 2.8 Å

PDB Description: three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
PDB Compounds: (B:) Serine protease/NTPase/helicase NS3

SCOPe Domain Sequences for d3kqkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kqkb1 c.37.1.14 (B:189-325) HCV helicase domain, N-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
qaetagarlvvlatatp

SCOPe Domain Coordinates for d3kqkb1:

Click to download the PDB-style file with coordinates for d3kqkb1.
(The format of our PDB-style files is described here.)

Timeline for d3kqkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kqkb2