Lineage for d1a4kb2 (1a4k B:120-213)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103878Species Diels alder catalytic Fab (mouse), kappa L chain [49060] (2 PDB entries)
  8. 103884Domain d1a4kb2: 1a4k B:120-213 [21249]
    Other proteins in same PDB: d1a4ka1, d1a4kb1, d1a4kh1, d1a4kl1

Details for d1a4kb2

PDB Entry: 1a4k (more details), 2.4 Å

PDB Description: diels alder catalytic antibody with transition state analogue

SCOP Domain Sequences for d1a4kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4kb2 b.1.1.2 (B:120-213) Immunoglobulin (constant domains of L and H chains) {Diels alder catalytic Fab (mouse), kappa L chain}
svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1a4kb2:

Click to download the PDB-style file with coordinates for d1a4kb2.
(The format of our PDB-style files is described here.)

Timeline for d1a4kb2: